GenomeNet

>ddi:DDB_G0289257 set1; SET domain-containing protein; K11422 histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43] (A)
MENETIVDNSLNNKSNVNNSNNDINNSKSNNNNTNTNYNNNHNNTTTTTTINKTEEKQND
SPKDSEFEFLDELKGVDDQHHVFSSEDESYTNGNKKRKQTDTPLSPNQDLKKRSITSPTT
SPTTSTSTSTSTSTSTSTSTIINNNNNNLKDKTKEEIEFIKHIRSQLVKPKFLKDKPNFP
LRSSGGNWIFVGKLPSLQSTTTDNTTLMSPNNATTTNGSSSNISTTTTTTTTTTPTTKIL
YRVNGFLSDNETIDSIEINFGDPRDRYEIERLHSSRINNPFELPCVSFKNPLFIKSNIAK
DIGISNEYGGMNDSFEFSNQPPPPSPPPPPPPTLPPPPPPTLPPQHSLEQQSTKQQIFTQ
QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQIPKINQQHYSTQPSVLIDDIYDPSNPTE
PISPHQDHYPNFIFSKLQRYEHLPTRNPISQYDYRDRPRDWERDRDRDWERDRDWERDRD
RERDRDRDRDWERDRDWERDRDWERDRDRDRDWERDRDRDWERDRDRDWERDRERDRDRY
DRQTNFSPAPQSTTTSASTSSTTSSTDKNSNNTTSTSVSATTSTTKRKSKFSEPIEPSPF
AIQIPRDNIKINGNLINNSSSSSSSGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSNNNN
NNSDVKDIKDKLLKQFKIYDPVNVYMDESYWYIDFRSSESRERAIQVLNGSFIDTWKLNV
DNKKTNTINEELQKQKQLENDSNNNKPNNFNLLENERSLKEICKLLVATELLSTSSKDIS
KNFIEAEILKTIKLLDSQRIDPLTQNSTIINNTTNTTTSNINNTSNNTTVTPIVTPKSII
SAPTSRDSPRGGRSSSTTTKKPSKLDLNGSGVPPTLKKLDTIKQQQQPQPPLSPLKRPPK
SHFYSDSEDDGNNNNDDDDDDDDDEDDDFDQELSPLHSSRDSKKNIKSIIKKKPIYSDDD
DDHYHHHNHHHNHHHHHHHDRSEVELYNESDLQVDVLDSDNENQDESDYHKSSDNFGHVE
LSDDDNEFDSLDTDQDLYDTEENDNGKKSNKRPRKSKFNGKSKKPTTTTSTTTTATKSKG
RSKKTTITTPTHNIPVLDEIQSNLDDEDASYVSMVMAADKDIKLLFSTKSEEGFEDSSQE
ILSTPTRTKPSRNRKERNLPFLDEEDDESFKQLPQPQQKQEKQEKHEHKLKNKELKQKNN
EVIINKTEEHFSENLNGDNNNNNDKSENENENENENKNENENDNNNLNTSIDNINGVERR
SITGCARSEGYTRSDIQKLFKRKQVAPTGKRGAASSASSGSNSSSSSTAESFETGGNLSK
SARSSRFDNRGFGSDPITLASLKSRRKRIKFERSDIHDWGLFAMETISAKDMVIEYIGEV
IRQKVADEREKRYVKKGIGSSYLFRVDDDTIIDATFKGNLARFINHCCDPNCIAKVLTIG
NQKKIIIYAKRDINIGEEITYDYKFPIEDVKIPCLCKSPKCRQTLN

BLAST