GenomeNet

>ddi:DDB_G0292760 lig4; BRCT domain-containing protein; K10777 DNA ligase 4 [EC:6.5.1.1] (A)
MALSLYYDEDDDENENENKDKPNNDFKNQQQINTSKTTNNNNNINNKNNYNNKFNDDDIF
NNDKIITKPRVTTTTTTTKNTSTNSNINKTKFNDDDIFDDEDEDSNSNKTTTTTTTTTTT
TDTIITNDYRYQKTVPFSSFCDLMNRIINDTKISNKKNYLEKFMNHYKDEPNNFYQLLRL
ILPQLDKDRNSYGLKEKTLARLYVELLNISPESVDAMRLLNWKKSTNDEIGGDFGTAVYL
SLKNRCNNDNGRIKVSMGDINESLDQLSQPLTDKKTKVSILKKVLRSTTAQEQKWFVRII
LKEMKNGLSDNITLKFFHPDAIDHFNITSNLRLVCTNLFYMTQSKQKELKDKQKLEEKEN
LLKQQQQQQNDLDIYKLEIKLFNPIKPMLANRQSIDNLSMILNSAISATQFVVEKKFDGE
RIQIHKDGEQVKYFSRNSNDSTGIYGSMFTPIVKECVLAERCILDGELIVWDSISQRFED
FGNLKTLALNKDGISGSGDPLGINYGKQLCFIAFDILFVKDQSVMNLPLMQRLMLLKRCV
TIKSKQFEISEQTTVNSISQIISLLESAIINREEGLMLKNLHSLYVPAERKDKWVKIKPE
YIDGMGNGADDLDLVIIGGYYGSGLNRRGGTISHFMLGVPFIADSTDTDIDDESTFDKNV
IFYSFCKVGSGYTDIQLKSLQKDLDPHWNNFSTSKPPSIIQLAEPFKEKPDVWIDPRVYS
KVLQIKASQIVVTDKYKCGYTLRFPRVLKIRDDKGWKDCCSHEEIIDLFTNYSTNLNFKR
DHEYGDGSGGKNKKLKKSKKTTNQLLADSGLKVLSIFQDTDTSGIIPTQNIFQGIEICVI
KGSSGEYTKSKLEIMIVEMGGSKVQYPSRNTNYVISSKEVVKIQNLIQSGFIDIVSFNWI
VDCYNEKRLVPLGPKYMIFSTESTKKRFLLDSDQFGDSYINETTEQSLKDSFNQIDKLKL
KKQLSINSTTTTTTTSISKYFSNCWWSLFKEFTFYLDLYQVVGEKSTLIENNNLELSNLN
IQFYGGKISIEFNNKITHVVLDSLDLSRITFIKNKINSLSLPIQIVTTNWIQLSINNYSI
QPILEILD

BLAST