GenomeNet

>ddr:Deide_23470 K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12] | (GenBank) putative dihydrolipoyllysine-residue succinyltransferase (Succinyl-CoA:dihydrolipoamide S-succinyltransferase) (A)
MKEVLLPELAESVVEGEILKWLVQEGDTIALEQPLCEVMTDKVTVELPSPVAGVLRQRLA
NEGDVVAVHAAIALIDETGGGASSSAPSAMQAIQDTAESPATADAQLPPQAQEEREQIGG
SIVEASHLPKADDDSSSLFKAFASDEQVKVQGLGGRTPAPQGAAQPVRNDGRVLAVPAAR
QLARELGLDLNRIQGSGPNGRIRVSDVLAQTQGQTASSTAASSMPASAPAPQPASTAQAA
AQPAPASSKAAQGGLPVAPVQYRTPKGYEHLEDRVPLRGMRRAISNQMVASHLYTVRTLT
VDEVNLTRLVEFRNRVKDEAKAADVKLSYLPFIFKAVAVALRKYPSLNTSFDEATQEIVQ
KRYYNMGMAVATDAGLTVPVLKDVGRKSVFELAREVVDLAGRAQAGKLQPDELAGSTFSI
TNIGSIGALFSFPIINVPDAAILGVHSIVKRPIVDEDDNIVVAHMMYLSLSFDHRLVDGA
EAARFCKEVIRLLENPDRLMLEAM

BLAST