GenomeNet

>deb:DehaBAV1_0769 no KO assigned | (GenBank) hypothetical protein (A)
MPSNPLEEYNRKRNFAQTAEPSGVKSVPSDKPVFVIQKHLASHLHYDFRLEIDGVLKSWA
IPKGPSANPKEKRLAVATEDHPMQYASFEGVIPEGEYGAGKVIVWDKGTFGNLKEGKTLA
ESYDTGHLVINLQGKKLKGGYSLLRTKMGWLMVKMEDAFADRLSDILNEQPASVITGKLV
EEII

BLAST