GenomeNet

>deb:DehaBAV1_0769 hypothetical protein (A)
MPSNPLEEYNRKRNFAQTAEPSGVKSVPSDKPVFVIQKHLASHLHYDFRLEIDGVLKSWA
IPKGPSANPKEKRLAVATEDHPMQYASFEGVIPEGEYGAGKVIVWDKGTFGNLKEGKTLA
ESYDTGHLVINLQGKKLKGGYSLLRTKMGWLMVKMEDAFADRLSDILNEQPASVITGKLV
EEII

BLAST