GenomeNet

>deg:DehalGT_0730 no KO assigned | (GenBank) DNA ligase D, 3'-phosphoesterase domain protein (A)
MPSNPLEEYNRKRNFAQTAEPSGVKSVPSDKPVFVIQKHLASHLHYDFRLEIDGVLKSWA
IPKGPSANPKEKRLAVATEDHPMQYASFEGVIPEGEYGAGKVIVWDKGTFGNLKEGKTLA
ESYDTGHLVINLQGKKLKGGYSLLRTKMGWLMVKMEDAFADRLSDILNEQPASVITGKLV
EEII

BLAST