GenomeNet

>deh:cbdb_A1142 hypothetical protein; K01622 fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11] (A)
MKVTLSVIKADIGGFVGHSDSHPQCLARAEKHLAEAKKKGMLIDYHITKCGDDLQLIMTH
QKGINNKVIHEMAWDTFVSCTEVAKELKLYGAGQDLLCDAFSGNVKGMGPGVAEMEIDER
PSEPIIIFMADKTSSGAWNLPLYKMFADPFNTIGLVIAENMHDGFSFEVHDVKESKGITF
NTPEEIYDLLVFIGAPSRFAIKSVSTRKGEIAAVSSTQKLALLAGRYVGKDDPVCIVRAQ
GAFPAVGEILEPFTQPYLVEGWMRGSHNGPIMPVSVEDSTPTRFDGPPRVTALGFQLSNG
MLIGPRDMFKDKSFDNARQKSLDMADMMRSHGPFEPHRLPLEEMEYTTMPQVSKKLAGRF
KPLKD

BLAST