GenomeNet

>deh:cbdb_A833 hypothetical protein (A)
MPSNPLEEYNRKRNFAQTAEPSGVKSVPSDKPVFVIQKHLASHLHYDFRLEIDGVLKSWA
IPKGPSANPKEKRLAVATEDHPMQYASFEGVIPEGEYGAGKVIVWDKGTFGNLKEGKTLA
ESYDTGHLVINLQGKKLKGGYSLLRTKMGWLMVKMEDAFADRLSDILNEQPASVITGKLV
EEII

BLAST