GenomeNet

>der:Dere_GG10995 K11404 histone deacetylase 3 [EC:3.5.1.98] | (RefSeq) uncharacterized protein (A)
MTDRRVSYFYNADVGNFHYGAGHPMKPQRLAVTHSLVMNYGLHKKMKIYRPYKASAQDML
RFHSDEYIAYLQQVTPQNIQCNSVAYTKYLAHFSVGEDCPVFDGLFDFCAMYTGASLEGA
QKLNHNHSDICINWSGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDVHHGD
GVQEAFYLTDRVMTASFHKYGNYFFPGTGDMYEIGAESGRYYSVNVPLKEGIDDQSYFQV
FKPIISAIMDFYRPTAIVLQCGADSLAGDRLGCFSLSTKGHGECVKFVKELNVPTLVVGG
GGYTLRNVARCWTHETSLLVDQDIENDLPATEYYDFFAPDFTLHPEINSRQDNANSKQYL
ELIVKHVYENLKMCQHSPSVQMVQTPPDVDLEELRNNREEASDPDVRMSVADEDKIVDAK
NEFYDGDQDQDKPDSAES

BLAST