GenomeNet

>der:Dere_GG13352 K13524 4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22] | (RefSeq) uncharacterized protein (A)
MRSLWLNTLTKQGLYRLSTKRYSTSIEPKEPVVKTKSIPGPKSIELKKQLDSVQATGTIQ
FFADYEKSIGNYIYDVDGNILLDVYTQISSVPLGYNHPRLYKVFNNEQNLKTLINRPALG
VFPGKEWPEKLHSVLLNIAPKGLNKITTMMCGSCSNENAYKSIFIWYQNKLRGNTPLTEQ
EKNSCMINIPPGAPNLSILSFKGAFHGRTLGALSTTHSKYIHKLDVPSFDWPIASFPEYR
YPLDENVAHNKKEDEKCLSEVQDLIQQYASKSPVAGIVVEPIQSEGGDNEASPEFFRSLQ
AICKKNGIALLIDEVQTGGGSTGKFWAHEHFELESPPDVVTFSKKLQLGGYFHNDDFIPN
EPYRIFNTWMGDPGKVLLLEEVVKVIQEEKLLANVDVAGKVLKNGLLSLEKEFPHILNST
RGRGTFLAVNCTNTKVRDQIIGALKLHGIQTGGCGEISIRFRPALIFKEYHANIVLDRFR
KVLQAI

BLAST