GenomeNet

>der:Dere_GG13871 K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] | (RefSeq) uncharacterized protein (A)
MNRLFVRRAGQQLTRTLLGPSASRLCQVTSVRDASCKDEYSLTDHKFDAIVIGAGGAGMR
AGFGLAEKGFQTAIISKLFPTRSHTVAAQGGVNAALSNMDKDDWKYHFYDTVKGSDWLGD
QNAIHYMCREAEKAICELDMYGMPFSRKPDGKIYQRPFGGQTLDYGKGGVARRACACADR
TGHALIHTLYGQTLKHSDCCHYFVDYFVLDLIMSRGACVGCLAWKLDDGTFHRFLANNTV
VAAGGCGRVYFSTTAGHTCTGDGNAWVSRQELPLMDMEFVQFHPTGIYGAGCLITEGVRG
EGGFFLNCKGERFMERYAPKAKDLASRDVVARAMTMEVLAGNGCGPLKDHVHLQLHHIDA
KIIRQRLPGILVTARIFAKVDVTKEPVPVLPTVHYNMGGIPTDYKGRVVTIDENGKEQVV
KGLYSCGETSCASVHGANRLGANSLLDLIIFGRVCALDIAANSCPGDKPPQVEDKATEKS
LDNFKRLRCADGCIPTAALRIELQRTMTKHAAVFREGKLLKEGLLKVAQLCEQFKDIKIT
DRTLVWNSNLVETLELQNMLANSVHIITAMENRKESRGSHAREDFNKRLDELDYGAPLAG
QKKKPIEEHWRKHTMTFALGDKGCASIKYRPVVDTTLDDSVAPIPPAPRTY

BLAST