GenomeNet

>der:Dere_GG13871 GG13871 gene product from transcript GG13871-RA; K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] (A)
MNRLFVRRAGQQLTRTLLGPSASRLCQVTSVRDASCKDEYSLTDHKFDAIVIGAGGAGMR
AGFGLAEKGFQTAIISKLFPTRSHTVAAQGGVNAALSNMDKDDWKYHFYDTVKGSDWLGD
QNAIHYMCREAEKAICELDMYGMPFSRKPDGKIYQRPFGGQTLDYGKGGVARRACACADR
TGHALIHTLYGQTLKHSDCCHYFVDYFVLDLIMSRGACVGCLAWKLDDGTFHRFLANNTV
VAAGGCGRVYFSTTAGHTCTGDGNAWVSRQELPLMDMEFVQFHPTGIYGAGCLITEGVRG
EGGFFLNCKGERFMERYAPKAKDLASRDVVARAMTMEVLAGNGCGPLKDHVHLQLHHIDA
KIIRQRLPGILVTARIFAKVDVTKEPVPVLPTVHYNMGGIPTDYKGRVVTIDENGKEQVV
KGLYSCGETSCASVHGANRLGANSLLDLIIFGRVCALDIAANSCPGDKPPQVEDKATEKS
LDNFKRLRCADGCIPTAALRIELQRTMTKHAAVFREGKLLKEGLLKVAQLCEQFKDIKIT
DRTLVWNSNLVETLELQNMLANSVHIITAMENRKESRGSHAREDFNKRLDELDYGAPLAG
QKKKPIEEHWRKHTMTFALGDKGCASIKYRPVVDTTLDDSVAPIPPAPRTY

BLAST