GenomeNet

>der:Dere_GG14088 K01785 aldose 1-epimerase [EC:5.1.3.3] | (RefSeq) uncharacterized protein (A)
MVNVTEEVFANGAVNPFTKSKDTIKRFTLSNGAGMSVQLITRGATITSIKTPDASGQIDD
VTLGFDDLAGYQSDRNPYFGATIGRVCNRIANGSFYLDGKLVEVSKNRDNKFQLHGGFVG
FDKAHWEVVEVCRDGVTLSHTNPDGHEGYPGNVTATASFTLSEDNCLHVQMSAVTDKTTP
VNLTNHSYFNLAGHKSGANGLYEHNIEINAYGITETDQSSIPTGGITPVEGTGFDLRVSS
NLGERLKALQPARGYDDNFCVTFTPPQPMVKVARATHPPSGRWLEVVSNQPGVQFYTSNF
MPDVERGETPIPGKDGAAYAKHGAFCLETQKFPDSVNHSNFPSTILRPGDSYRHEVIYKF
GVSH

BLAST