GenomeNet

>der:Dere_GG14320 K00310 pyrimidodiazepine synthase [EC:1.5.4.1] | (RefSeq) uncharacterized protein (A)
MSSGKHLTKGSPKPALPDDGVLRLYSMRFCPYAQRAHLVLNAKNVPHHSIYINLTEKPEW
LVDVSPLLKVPALQLVAEKDQPSLIESLIIAEYLDEKYPENPLLPKDPLRRAQDKILLER
FSGITNAFMKILLQSTGLEDYWAALDIFEQELTKRGTPYFGGNKPGFVDYMIWPWFERLS
VIELKLQEEYNFDEARFPKISKWIALLKADSVVKSFYATPEQHNEFWRTRKAGNANYDLL
A

BLAST