GenomeNet

>der:Dere_GG17130 K10776 DNA ligase 3 [EC:6.5.1.1] | (RefSeq) uncharacterized protein (A)
MLLPRLTWQTRFLTRLACNKMASKGLRNEDNKFDTFRRICDEIAGESSYLKKAEKLQRFF
EKGSSGKGFKGDTLLWVQFLIPEANQRVYNLQNKALIKLFSRILNANQQQMHLDLEQDGD
VSETLRKHFAASRKLKPQVQSKLYLQEVEQLLLKLVERTKEDEQTELLHELCSKATDLDL
RTFIRLVKHDLRINARARHILDAFGSEAYPAYQSSRDLVAIVGQFAGKDNKKDAHSPIKK
ANKTNSSAIQVMTPISPMLASPCKSVEEAFKKSPTGLYSEIKYDGERVQIHKQGNEFKFF
SRNLKPVVDHKIRALKEYIPQAFPGGGEMILDSEIILVDTDTGALLPFGSLGAHKKQTFA
NAAVCLFVFDCILYDGEDLTQLPFRKRREILEQNIQPIKSHVQLSESEFLKTTKELAVMT
ARVLHANLEGVVLKSPTSTYQPGKRNWLKVKKDYLFDGKMADTADLVVLGAWYGSGKKGG
TLSIFLMGCYDAFGRLWKTVTKVHSGLDDATNAEVHESLIKLTERADANAIPSWLLCSKS
LVPDVLAKDPLKMPVWEITGAEFTKSDAHTASGISIRFPRITRRRSDKSAKEANDLAHLE
DIFEASKTNVNVDLLLANCSKDEKAIDIKTSPQKEKKLNGNRSSSTKKLKRRKTSTDDED
EAPALSKHKEAKAIRSLSPSQKGLKDFFKPSKELKSVVKKEPKQTENATEPTSSKGKLFE
GLVAYFAMEKDSSKLMQQFSQHGGSCTTEPRKANLVFYNTNEASDMEKLRRLYRRSCRHL
NVSWLQNSLDTQSRQPYPLYAVMMK

BLAST