GenomeNet

>der:Dere_GG17149 K01834 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11] | (RefSeq) uncharacterized protein (A)
MLALARNSWCGQLLSRLANIEARCPYSKTSAGGKQGEKKGKYRIVMVRHGESEWNQKNLF
CGWFDAKLSEKGQQEACAAGKALKDANIEFDVAHTSVLTRAQETLRVALKSSEHKKIPVC
TTWRLNERHYGGLTGLNKAETAKKFGEEKVKIWRRSFDTPPPPMEKDHEYYACIVEDPRY
KDQLKPEEFPKSESLKLTIERTLPYWNEVIVPQIKDGMRVLIAAHGNSLRGVVKHLECIS
DKDIMSLNLPTGIPFVYELDESIKPLATLKFLGDPETVKKAMESVANQGKAK

BLAST