GenomeNet

>der:Dere_GG19704 K00799 glutathione S-transferase [EC:2.5.1.18] | (RefSeq) uncharacterized protein, isoform C (A)
MASPVELLSLSNPVFKSFTFWVGVLVIKMLLMSLLTGIQRFKTKTFANPEDLMSPKLKVK
FDDPNVERVRRAHRNDLENILPFFAIGLLYVLTDPTAFLAINLFRAVGIARIVHTLVYAV
VVVPQPSRALAFFVALGATVYMALQVIASAAF

BLAST