GenomeNet

>der:Dere_GG19893 K11421 histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43] | (RefSeq) uncharacterized protein (A)
MSGESIAMDSTESSGIAVVSGQETPASREKSYSTPVEGENRSESTVSAKKEGQAAKDVEM
ADLTLEDPPHSEAIDTPDSTRKQPPDVGNTPDEPGKRGEESEDPKGGNKKDVSIDIASSP
VLVAVDSDSSVELIESPAKSPSSDESVKDPPISDTANGAAAVEAKEAEELADSSIDLITS
PTSESTPEKDEGIKKQEQQKNENEPDNSTKETEAPGMEVEQDVEASISHANEEDKIEKTL
KEHKPISSMEIEDHHIVDKKDDVLEVELEKGTVPKAAQDEQLNDLPSDGEMFYDKDCVNC
NCKKLHKQYVLANMATLNFYQVLRKTSKQQFLCMGCHDTAMDLYEECAGQLLANQPLLLK
DFQQDQADFVALDSSDEEDEEKQPEKAHFSKNKLQFIEEELEDAITSVLNKVDFTVQLSW
SKTILQAKADHLERQFALADVELEKVQTTADKMHYALYNSCPVAHKHLPPLDIEPSVGDY
VHHVPPAGEIVRPPIQLGETYYAVKNKAIASWVSIKVIEFTESTAINGNTMKSYKIRYLN
TPYQMIKTVTAKHIAYFEPPPVRLTIGTRVIAYFDGTTLSRGKDKGVVQSAFYPGIIAEP
LKQANRYRYLIFYDDGYTQYVPHRDVRLVCQASEKVWEDVHAASRDFIQKYVEKYSVDRP
MVQCTRGQSMNTESNGTWLYARVIDIDCSLVLMQFEGDKNHTEWIYRGSLRLGPVFRETQ
NTMNSSSAQQMRVPRRTEPFIRYTKEMESSSKVNQQMRAFARKSSASGQNVALAAAASSS
ATSGGGRTNVGGASTSNSASAVRHLNNSTIYVDDENRPKGHVVYFTAKRNLPPKMYKCHE
CSPNCLFKIVHRLDSYSPLAKPLLSGWERLVMRQKTKKSVVYKGPCGKSLRNLAEVHRYL
RATENVLNVDNFDFTPDLKCLAEYSIDPSIVKDTDISRGQEKMAIPLVNYYDNTLPPPCT
YAKQRIPTEGVHLNLDEEFLLCCDCEDDCSDKSKCACWQLTVAGVRYCNPKKPIEEIGYQ
YKRLHEHVPTGIYECNSRCKCKKNCLNRVVQFSLEMKLQVFKTSNRGWGLRCVNDIPKGA
FICIYAGHLLTETMANEGGQDAGDEYFADLDYIEVAEQLKEGYESEVDHSDPDAEEDNGG
PDAEDDDDFRPNYHYQRKIKRTSRSNSTQSSELDSQERAVINFNPNADLDETVRENSVRR
LFGKDEAPYIMDAKTTGNLGRYFNHSCNPNLFVQNVFVDTHDLRFPWVAFFSAAHIRSGT
ELTWNYNYEVGVVPGKVLYCQCGAPNCRIRLL

BLAST