GenomeNet

>der:Dere_GG20196 K01312 trypsin [EC:3.4.21.4] | (RefSeq) uncharacterized protein (A)
MAVCGIVGAVLVLLLLGEASDVETTGRIVGGSNQLIRNAPWQVSIQISARHECGGVIYSK
EIIITAGHCLHEKSVSLMKVRVGAENHNYGGTLVPVAAYQVHEQFDSRFLHYDIAVLRLS
TPLTFGLSTRAINLASKSPTGGTTVTVTGWGHTDNGALSDSLQKAQLQIIDRGECASPKF
GYGADFVGEETICAASTDADACTGDAGGPLVASSQLVGIVSWGYRCVDDNYPGVYADVAF
LRPWIVKAANAI

BLAST