GenomeNet

>der:Dere_GG22242 K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] | (RefSeq) uncharacterized protein, isoform A (A)
MFVARKITQTASLAVRGKHTLPKLPYDYAALEPIICREIMELHHQKHHQTYVNNLNAAEE
QLEEAKSKSDTTKLIQLAPALRFNGGGHINHTIFWQNLSPNKSQPSDDLKKAIESQWKSF
EEFKKELTTLTVAVQGSGWGWLGFNKKSGKLQLAALPNQDPLEASTGLIPLFGIDVWEHA
YYLQYKNVRPSYVEAIWDIANWDDISCRFQEAKKLSC

BLAST