GenomeNet

>der:Dere_GG23885 no KO assigned | (RefSeq) uncharacterized protein (A)
MLASENFPTHHFKESIFKPYSTSGDDLASVTPLTAAAALVASTSSPADSSSAVAFETASK
MLTTTNSNNNNNNTTSAKDDLSSFVASHPAAEFEGFIRACVDEIIKLAVFQGTNRSSKVV
EWHEPAELRQLFDFQLREKGESQDKLRELLRETIRFSVKTGHPYFINQLYSGVDPYALVG
QWLTDALNPSVYTYEVAPLFTLMEEQVLAEMRRIVGFPNGGQGDGIFCPGGSIANGYAIS
CARYRHSPESKKNGLFNAKPLIIFTSEDAHYSVEKLAMFMGFGSEHVRKIATNEVGKMRL
SDLEEQVKQCLENDWQPLMVSATAGTTVLGAFDDLAGISDVCKKYNMWMHVDAAWGGGAL
MSKKYRHLLSGIERADSVTWNPHKLLAASQQCSTFLTRHQQVLAQCHSTNATYLFQKDKF
YDTSFDTGDKHIQCGRRADVFKFWFMWKAKGTQGLEAHVEKVFRMAEFFTAKVRERPGFE
LVLESPECTNISFWYVPPGLREMERNREFYDRLHKVAPKVKEGMIKKGSMMITYQPLRQL
PNFFRLVLQNSCLEESDMVYFLDEIESLAQNL

BLAST