GenomeNet

>det:DET0850 no KO assigned | (GenBank) conserved hypothetical protein (A)
MPASPLEEYNRKRDFNKTAEPSGTKSPPSANPVFVVQKHLASHLHYDFRLEIDGVLKSWA
VPKGPSASPKEKRLAVATEDHPMQYASFEGVIPAGEYGAGKVIVWDRGTFQNLKDGKTLE
ESYSTGHLVINLQGEKLKGGYSLLRTKMGWLMVKMEDEFARPLSDILNEQPASVISGRLV
EEI

BLAST