GenomeNet

>det:DET0850 hypothetical protein (A)
MPASPLEEYNRKRDFNKTAEPSGTKSPPSANPVFVVQKHLASHLHYDFRLEIDGVLKSWA
VPKGPSASPKEKRLAVATEDHPMQYASFEGVIPAGEYGAGKVIVWDRGTFQNLKDGKTLE
ESYSTGHLVINLQGEKLKGGYSLLRTKMGWLMVKMEDEFARPLSDILNEQPASVISGRLV
EEI

BLAST