GenomeNet

>dfe:Dfer_4396 thymidine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MFVEPSHRREFQNPRTGWIEVICGSMFSGKTEELIRLLNRARIARQRIQIFKPALDKRYH
EENIVSHNDNSIPSIPVQSSQQISDLAQDCEVVGIDEAQFFDEGILAVCDQLANSGKRVI
VAGLDMDYMGKPFGCMPQLMAIAEYVTKVHAVCMVCGEVASHSYRLSPSNERVLLGETDH
YEARCRRCFNLGEKATELFSR

BLAST