GenomeNet

>dgr:Dgri_GH21756 GH21756 gene product from transcript GH21756-RA; K00235 succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1] (A)
MLVNEARQILSRASSLAARHQLRAISNSSQLEQQAQPKESQAPQIKKFEIYRWNPDNAGE
KPYMQTYEINMRECGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGTNTLACI
SKIDATSSKPLKVYPLPHMYVVRDLVPDMNNFYEQYKNIQPWLQRKNEAGEKKGKAQYLQ
SVEDRSKLDGLYECILCACCSTSCPSYWWNAEKYLGPAVLMQAYRWIIDSRDEMTVERLS
KLKDPFSVYRCHTIMNCTRTCPKGLNPGRAIAEIKKLLSGLASKPAPKLETAALHK

BLAST