GenomeNet

>dgr:Dgri_GH21756 K00235 succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1] | (RefSeq) GH21756 gene product from transcript GH21756-RA (A)
MLVNEARQILSRASSLAARHQLRAISNSSQLEQQAQPKESQAPQIKKFEIYRWNPDNAGE
KPYMQTYEINMRECGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGTNTLACI
SKIDATSSKPLKVYPLPHMYVVRDLVPDMNNFYEQYKNIQPWLQRKNEAGEKKGKAQYLQ
SVEDRSKLDGLYECILCACCSTSCPSYWWNAEKYLGPAVLMQAYRWIIDSRDEMTVERLS
KLKDPFSVYRCHTIMNCTRTCPKGLNPGRAIAEIKKLLSGLASKPAPKLETAALHK

BLAST