GenomeNet

>dha:DEHA2G19382g DEHA2G19382p; K00235 succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1] (A)
MFKSIIRQRSSFLGQRFRNLATSANAETRMKKFQIYRWNPDTPEVEPKMNTYEVDLNQCG
PMVLDAIIKIKNEQDATLTFRRSCREGICGSCAMNIGGRNTLACLCRIEEDTSKDLKIYP
LPHMFVVRDLVPDLTHFYKQYKSIQPYLQRDTHPEDGRENLQSIEDRAKLDGLYECILCA
CCSTACPSYWWNQQQYLGPAVLMQAYRWLIDSRDQASRARKEMLQNSMSLYRCHTIMNCS
RTCPKGLNPGKAIAEIKKQLAFD

BLAST