GenomeNet

>dha:DEHA2G24640g mitochondrial 37S ribosomal protein RSM26; K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] (A)
MFRRSYKLANSSISVAKRKLHEVPALKNQDAFLQNGIEGLYSPKGFKSAWSDYQKYLTLN
LTLQTNGTENELRMPYQILLQTAKQTAEQHTFHFASQAHNNHFCFEQLTNKTEAQKTKPS
RFLLERLADQDFANIESFRDHFLLVADSSFGQGWVFLVELPDKSVKILKCGNDGTPYFYG
KNQSLDLNGGIDEGSFEYLNNLKHLAAKQERDFSLPLLGINCWDTAFIDDYGVTGKADYL
TNFWDCINWDVVNKRLFQV

BLAST