GenomeNet

>din:Selin_0159 carbamoyl-phosphate synthase large subunit; K01955 carbamoyl-phosphate synthase large subunit [EC:6.3.5.5] (A)
MPKRTDIKKILVIGSGPIVIGQACEFDYSGTQAIKALKEEGYEVVLINSNPATIMTDAQM
ADATYIEPITASVIEKIIEKERPCAILPTVGGQTALNAAVEVAETGILKKYNVEMIGANL
KAIQKGEDRELFKEAMNRIGLEMPRCGYAHSLEEARKIVREMGLPAIIRPSFTLGGSGGG
IAYNMEEFDEIVASGLDASPSREILIDESIIGWKEYEMEVMRDKNDNVVIICSIENFDPM
GVHTGDSITVAPAQTLSDKEYQLMRDATIKVIREIGVDTGGSNVQFAVNPDDGRLVIIEM
NPRVSRSSALASKATGFPIAKIAAKLAVGYTLDEIPNDITKETPASFEPTIDYVVVKYPR
FTFEKFPNANATLTTQMKSVGEAMSIGRTFKESFQKVLRSLEIDSYGFESRLSEEQIKKP
NSDTIALIENKLRIPNWERVWYIGDAFRIGFTIERIHQITNIDPWFLEELRQIVEMDERI
AHLGSYRDLNTDLLRQIKEMGFSDRRIAQLTSTDEQSIERLRKDQGVVPVFKRIDTCGAE
FEAQTPYLYSTYEEECEAAPTDRKKIMIIGGGPNRIGQGIEFDYCCCHAAFALSEDGFET
IMVNCNPETVSTDYDTSDRLYFEPVTREDILSIVEKEKPHGLIIQFGGQTPLKLAVALEK
ANVPILGTSPDAIDRAEDRERFKKLVEKLELKQPANATATSEAQALEIAERIGYPVVVRP
SYVLGGRAMEIVYNVDALKNYMEKAVKASPEHPVLIDHFLEHATEVDVDAVCDGENVIVA
GIMEHIEEAGIHSGDSACSLPPKSLSAEICEEIRRQTRLLALELKVVGLMNIQFAIKGGE
IYLIEVNPRASRTVPFVSKATGIPFAKIAALVMAGRKLPELGLTRDVEPEYFSVKESVFP
FIKFPGVDTILGPEMRSTGEVMGIDPEFGIAFAKAQSGAGGTLPLKGTVFISVRNEDKEH
IPDIARKLIALGFKVVATRGTAAYLKSKGIEATPVHKVNEGRPNIVDLIVNGSIALVFNT
PGGEKTKADALSIRRSVLTYKVPYFTTVEGAKAAVTAIEAEKNDQLHVKPLQEHYLNNAY
LKDMPLR

BLAST