GenomeNet

>dka:DKAM_0499 aldehyde ferredoxin oxidoreductase-like protein; K11389 glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6] (A)
MNMRRYRALFIDASTRKHWVEEYELNEVYSPISLGLKLHMERYRSWSKPIYHSDNALILG
AGLFTGSKMYGVHRFVAVFRSPLTKGLHVSEMGGAAFQFKINADAVVIVGRSETPLIVKI
YDQGNGEPVVEFHEIQEETLEHVWKGYGGFKGIYALQQYLSDHFKGFYEEFNGRSILVGP
ASKYTNIGALASVTLNKGRMDHGSEDFAARAGGGSILYRAHGVAAIIYGGRYDRSTKVPK
ELSDTRELDKLFMELTKQPYTQAVINAGVKYRYDPKLNTGGTLGGNYPHLKATTPMFNWK
MIYLPKDLREKLHELIMKYMWEPFNREAIETRSWKTCGEPCPLACKKVRLGKYKSDYEPY
NGLGPIIGVLDIHEAEKVVELADAYGFDAIELGQIIGFLFEAMDKGLLRPEEIGLPGKPF
FDPASYSIEHARVNAELAVKIIEQLAFGSNPLLRLIGERGLRSAAKILDILYRERTIERK
TRFSDIPIYAVFGEEGHITPNYYWTPGLVAPLVVLGKYWTVYSGVFMEPEEFASKSIERA
IYEALIADMGLCRFHRGWAEKAIPVILEKYYGVEKPLEKTRELYKKIAEYQKLAGALPVF
WDSGKIIDFMAHAAEEYGNVEWGGKFKVNKEAAAREWWERFYRKLEELTS

BLAST