GenomeNet

>dku:Desku_0983 DNA polymerase LigD, ligase domain protein (A)
MEGQVSLPLLKPMLATSSRPFDSPDFLYEVKWDGYRVLAYLDGDTLLRSRNLRDITATFP
ELDELHKCVKNQPAIVDGEIVIFQDGRPSFAALQARGRLEDPLKIKSMVRRYPAILMAFD
VLYAGGRSLLNEPLRRRKEILTEMINPGDQVLVSEFVLHQGRAFADACAAWGLEGAMAKH
LDSPYLPGQRSPYWRKFRHTKEADLVICGYQEGLGRRRLGALVLGGYRSGELVYQGKVGT
GFSREEEERLLELLSRLVIPRPVLALPPVEARRTIAVEPVLVCAVEYLSLTAGGLLRHCS
YRGLRPDKSPRECHFLLK

BLAST