GenomeNet

>dly:Dehly_0468 K01155 type II restriction enzyme [EC:3.1.21.4] | (GenBank) Type II site-specific deoxyribonuclease (EC:3.1.21.4) (A)
MELNFDPSIAASYHSPTQKARVLTEGWVAGQSYCPNCGHRQLNQFEAGRRVADFFCSVCG
EEFELKSKKSVLTGRVVDGAFSAMMERLTSRTNPNLFLMNYDAISHSVTDFLVVPKHFFT
PTIIEKRKALSPTARRAGWVGCNILIDDIPRPGRIYLVRNRNIEPLSDVMATWQKTLFLR
EETNFDSKGWLLDIMSCMDKLNSNEFKLSQIYEFTPILEKLHPDNHHIKDKIRQQLQVLR
DRGLLEFLGNGHYRLK

BLAST