GenomeNet

>dma:DMR_29360 aldehyde ferredoxin oxidoreductase family protein; K03738 aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5] (A)
MVCGWNRCILRVDLSEKTVQSIPLSEELLEKYLGGMGLADKIIWDYILEKDIRAGFDPLS
PDNIFVIAMGPLTGLSTQGGRGIYQYISPVTGHLGGGSGGGFVHAMLKQAGYDALVITGK
ADQPVYLWIDDDSVSIKDASELWGLGAHQTVSTLKKQHGEVCSVVIGPAGENLVRHATAM
IDGFKSAGGKCGTGAVLGSKNLKAIVVRGKKGVNVADPKAFLENDADFRNAIKENSAWPR
FALWLAYFHTTPFKPRLAEHIYDYAVRLEACWNCHMACCGYHEQSRGKYPTRGTGPEIAN
QESFSALGVNDLEALNYYSDLLNDYGIDWKEGPGDIGIVMQLYKDGVLSAKDTDGLELDS
GDGKIIEEMIHWMAKRERIGNLVAEGKMNIARLFPEARKYDNTVRGTTGYGKDDPRTDRR
NIGPAVMCHFTPYRGACLETWGWQSIGLADFSWEFPGKEGLRSGRGYTREEAAEIVKEVV
GADDHAMFSKGEPKGWCKLNVRIGNWVVANESLILCRRIACIVDNNITRAGISARMLSTA
TGKEFTTESIERIGERIFNLQRMIDARLGITRTQDKFPEYFYQPLGDGMGGLTEEDEKVI
HEEMDYYYSLRGWDLETGQPTKEKAEELGLAIEWTALQKDGPYKDWEGPPLAGVSRGQRA
AS

BLAST