GenomeNet

>dma:DMR_29360 K03738 aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5] | (GenBank) aldehyde ferredoxin oxidoreductase family protein (A)
MVCGWNRCILRVDLSEKTVQSIPLSEELLEKYLGGMGLADKIIWDYILEKDIRAGFDPLS
PDNIFVIAMGPLTGLSTQGGRGIYQYISPVTGHLGGGSGGGFVHAMLKQAGYDALVITGK
ADQPVYLWIDDDSVSIKDASELWGLGAHQTVSTLKKQHGEVCSVVIGPAGENLVRHATAM
IDGFKSAGGKCGTGAVLGSKNLKAIVVRGKKGVNVADPKAFLENDADFRNAIKENSAWPR
FALWLAYFHTTPFKPRLAEHIYDYAVRLEACWNCHMACCGYHEQSRGKYPTRGTGPEIAN
QESFSALGVNDLEALNYYSDLLNDYGIDWKEGPGDIGIVMQLYKDGVLSAKDTDGLELDS
GDGKIIEEMIHWMAKRERIGNLVAEGKMNIARLFPEARKYDNTVRGTTGYGKDDPRTDRR
NIGPAVMCHFTPYRGACLETWGWQSIGLADFSWEFPGKEGLRSGRGYTREEAAEIVKEVV
GADDHAMFSKGEPKGWCKLNVRIGNWVVANESLILCRRIACIVDNNITRAGISARMLSTA
TGKEFTTESIERIGERIFNLQRMIDARLGITRTQDKFPEYFYQPLGDGMGGLTEEDEKVI
HEEMDYYYSLRGWDLETGQPTKEKAEELGLAIEWTALQKDGPYKDWEGPPLAGVSRGQRA
AS

BLAST