GenomeNet

>dme:Dmel_CG10045 K00799 glutathione S-transferase [EC:2.5.1.18] | (RefSeq) GstD1; glutathione S transferase D1, isoform B (A)
MVDFYYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNG
FALWESRAIQVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAK
APADPEAFKKIEAAFEFLNTFLEGQDYAAGDSLTVADIALVATVSTFEVAKFEISKYANV
NRWYENAKKVTPGWEENWAGCLEFKKYFE

BLAST