GenomeNet

>dme:Dmel_CG10593 K01283 peptidyl-dipeptidase A [EC:3.4.15.1] | (RefSeq) Acer; Angiotensin-converting enzyme-related, isoform B (A)
MGACNITVLLLVIMLWLPHGLSMGNSCSASVLEARRFFELENEQLRRRFHEEFLSGYNYN
TNVTEANRQAMIEVYARNAELNKRLAQQIKSSDYVQSEDADIRRQAEHLSKLGASALNAD
DYLALQNAISSMQTNYATATVCSYTNRSDCSLTLEPHIQERLSHSRDPAELAWYWREWHD
KSGTPMRQNFAEYVRLTRKASQLNGHRSYADYWVQFYEDPDFERQLDATFKQLLPFYRQL
HGYVRFRLRQHYGPDVMPAEGNIPISLLGNMWGQSWNELLDLFTPYPEKPFVDVKAEMEK
QGYTVQKLFELGDQFFQSLGMRALPPSFWNLSVLTRPDDRHVVCHASAWDFYQDSDVRIK
MCTEVDSHYFYVVHHELGHIQYYLQYEQQPAVYRGAPNPGFHEAVGDVIALSVMSAKHLK
AIGLIENGRLDEKSRINQLFKQALSKIVFLPFGYAVDKYRYAVFRNELDESQWNCGFWQM
RSEFGGVEPPVFRTEKDFDPPAKYHIDADVEYLRYFAAHIFQFQFHKALCRKAGQYAPNN
SRLTLDNCDIFGSKAAGRSLSQFLSKGNSRHWKEVLEEFTGETEMDPAALLEYFEPLYQW
LKQENSRLGVPLGWGPTDKIPSDCCGTFST

BLAST