GenomeNet

>dme:Dmel_CG10593 Acer; Angiotensin-converting enzyme-related (EC:3.4.15.- 3.4.24.-); K01283 peptidyl-dipeptidase A [EC:3.4.15.1] (A)
MGACNITVLLLVIMLWLPHGLSMGNSCSASVLEARRFFELENEQLRRRFHEEFLSGYNYN
TNVTEANRQAMIEVYARNAELNKRLAQQIKSSDYVQSEDADIRRQAEHLSKLGASALNAD
DYLALQNAISSMQTNYATATVCSYTNRSDCSLTLEPHIQERLSHSRDPAELAWYWREWHD
KSGTPMRQNFAEYVRLTRKASQLNGHRSYADYWVQFYEDPDFERQLDATFKQLLPFYRQL
HGYVRFRLRQHYGPDVMPAEGNIPISLLGNMWGQSWNELLDLFTPYPEKPFVDVKAEMEK
QGYTVQKLFELGDQFFQSLGMRALPPSFWNLSVLTRPDDRHVVCHASAWDFYQDSDVRIK
MCTEVDSHYFYVVHHELGHIQYYLQYEQQPAVYRGAPNPGFHEAVGDVIALSVMSAKHLK
AIGLIENGRLDEKSRINQLFKQALSKIVFLPFGYAVDKYRYAVFRNELDESQWNCGFWQM
RSEFGGVEPPVFRTEKDFDPPAKYHIDADVEYLRYFAAHIFQFQFHKALCRKAGQYAPNN
SRLTLDNCDIFGSKAAGRSLSQFLSKGNSRHWKEVLEEFTGETEMDPAALLEYFEPLYQW
LKQENSRLGVPLGWGPTDKIPSDCCGTFST

BLAST