GenomeNet

>dme:Dmel_CG11793 K04565 superoxide dismutase, Cu-Zn family [EC:1.15.1.1] | (RefSeq) Sod1; superoxide dismutase 1, isoform A (A)
MVVKAVCVINGDAKGTVFFEQESSGTPVKVSGEVCGLAKGLHGFHVHEFGDNTNGCMSSG
PHFNPYGKEHGAPVDENRHLGDLGNIEATGDCPTKVNITDSKITLFGADSIIGRTVVVHA
DADDLGQGGHELSKSTGNAGARIGCGVIGIAKV

BLAST