GenomeNet

>dme:Dmel_CG12559 rl; rolled (EC:2.7.11.- 2.7.11.24); K04371 mitogen-activated protein kinase 1/3 [EC:2.7.11.24] (A)
MEEFNSSGSVVNGTGSTEVPQSNAEVIRGQIFEVGPRYIKLAYIGEGAYGMVVSADDTLT
NQRVAIKKISPFEHQTYCQRTLREITILTRFKHENIIDIRDILRVDSIDQMRDVYIVQCL
METDLYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICD
FGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPI
FPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESLPFKPNVPWAKLFPNADALAL
DLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEPVAEVPFRINMENDDISRDALKSLI
FEETLKFKERQPDNAP

BLAST