GenomeNet

>dme:Dmel_CG14994 K01580 glutamate decarboxylase [EC:4.1.1.15] | (RefSeq) Gad1; glutamic acid decarboxylase 1, isoform D (A)
MSLNPNGYKLSERTGKLTAYDLMPTTVTAGPETREFLLKVIDVLLDFVKATNDRNEKVLD
FHHPEDMKRLLDLDVPDRALPLQQLIEDCATTLKYQVKTGHPHFFNQLSNGLDLISMAGE
WLTATANTNMFTYEIAPVFILMENVVLTKMREIIGWSGGDSILAPGGSISNLYAFLAARH
KMFPNYKEHGSVGLPGTLVMFTSDQCHYSIKSCAAVCGLGTDHCIVVPSDEHGKMITSEL
ERLILERKAKGDIPFFVNATAGTTVLGAFDDINTIADICQKYNCWMHIDAAWGGGLLMSR
KHRHPRFTGVERADSVTWNPHKLMGALLQCSTIHFKEDGLLISCNQMSAEYLFMTDKQYD
ISYDTGDKVIQCGRHNDIFKLWLQWRAKGTEGFEQQQDRLMELVQYQLKRIREQSDRFHL
ILEPECVNVSFWYVPKRLRGVPHDAKKEVELGKICPIIKGRMMQKGTLMVGYQPDDRRPN
FFRSIISSAAVNEADVDFMLDEIHRLGDDL

BLAST