GenomeNet

>dme:Dmel_CG1640 K00814 alanine transaminase [EC:2.6.1.2] | (RefSeq) CG1640, isoform G (A)
MSRMLIKPAAATVSAALQQHQRQQQQYVIRRWKSFLHNNSNNANRRAAKSTATATVTAAA
TSQRHGTSGDFIQPLDVRRSFSTSHKMPSSSKALTLDNINPNFIAMEYAVRGPLVIRAGE
IEKELEKGVKKPFDQVIRANIGDCHAMGQQPLTFLRQLLALTFETRLLDSPDYPEDVKKR
ACAILNGCQGQSVGSYTDSAGLEVVRRQVAQYIEKRDGGIASNWQDIYLTGGASPGIKSI
LSMINAEVGCKAPGVMVPIPQYPLYSATISEYGMTKVDYYLEEETGWSLDRKELQRSYDE
AKKVCNPRALVVINPGNPTGQVLTRENIEEIIKFAHDNKVLVLADEVYQDNVYDKNSKFW
SFKKVAYEMGDPYRNLEMVSFLSTSKGYLGECGIRGGYMEVLNLDPKVKAMLTKSITAAL
CSTTAGQVAVSALVNPPQPGEPSYDLYKKERDGILAALKERAELVHKALNSFEGYKVNPV
QGAMYVFPQIEIPPKAIEAAKAKGMAPDVFYAFELLETSGICIVPGSGFGQKPGTWHFRS
TILPQTDKLKLMMEKFRVFHAEFMKKYK

BLAST