GenomeNet

>dme:Dmel_CG17323 K00699 glucuronosyltransferase [EC:2.4.1.17] | (RefSeq) CG17323; uncharacterized protein, isoform E (A)
MWSPRVALLFLALALSQPDELVEAAGPLKVLGLFPHPGVSHFHFFHPIMKGLAEAGHDVS
VVSHFPDKHPVAHYKDFPLTGMDKLTNSVDLKFFEKRTFYSHFQEFFLLYDWGKQTCNLT
LRSEALQQILRRPGRFDVIIMEQFNTDCMMGVAHQLQAPVIALSSCVMMPWHYERMGAPL
IPSHIPALFMAQSQHMNFGGRLANWFSTHALNWMYKLLSVPAADAMVQYKFGHDVPSVGE
LVKNTSMFFVNQHYSLSGPKVTPPNVIELGGIHIQKSKPLPADLQRILDNAEEGVILISW
GSMIRANSLSAAKRDGIIRAVARLKQKVIWKWENETLPNQPPNMHIMKWLPQRDILCHPN
VKVFMSHGGLMGTSEAAYCGVPVVATPMYGDQFVNTAALVERGMGTILNFEDIGENTVMR
ALKKALDKKFHDAAKVVSHSFHHRPQQALHTAIWWVEHVAHTGGAPLLKPSAVEMSRFVY
YSLDVYAVLALVLGSIIASWVWLLRLCCGSSAAQKTKKD

BLAST