GenomeNet

>dme:Dmel_CG18548 K00799 glutathione S-transferase [EC:2.5.1.18] | (RefSeq) GstD10; glutathione S transferase D10, isoform B (A)
MDLYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHG
FALWESRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLK
KPANEENYKKIEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTFDVAGFDFKRYANV
ARWYENAKKLTPGWEENWAGCQEFRKYFDN

BLAST