GenomeNet

>dme:Dmel_CG32445 K01785 aldose 1-epimerase [EC:5.1.3.3] | (RefSeq) CG32445; uncharacterized protein (A)
MVRVIEDMFGIAVNPMTQKTDRVRRFTLVTERGMSVSILTMGAIIQSLKVPDFNGKLEDV
CLGYDDVAGYYRNQQYFFGATIGRVANRTAHGRFKLCGKEVSVSRNLRDRHHQNGGFVGF
DSVIWDVVGVHKDGVTLQHISPDGHEGYPGELTTNINFSLNETGCFGMRIEARTKATTAV
NISNHSFFNLAGHGAGRDTLYQHMLMIKAQKIVDVDQELLPTGKLMRVRTTPYDFSSLVS
LGKRLNQVSTCPLGGFDNHFCVDIPPNRVQLVARVVHPCSGRFMEVHTNQPGLQFSTANH
LPSEDGSDIPIAGKDGVNYVRQGAFTLETQKYPDAMNHCDFPSVVLNPGQLYDHQVVYRF
GSCPKRV

BLAST