GenomeNet

>dme:Dmel_CG33791 K00164 2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2] | (RefSeq) CG33791; uncharacterized protein, isoform C (A)
MNQCRLRSLARIRRSLTLGLRGTDQHVLARQALRTIQTTSQRRGVHDLDSFANGCSAAYI
EGLYNKWKRNPSSVDESWNELFSSNDWSSPKRSPLQVSHSRKYRRPPVERIAVKARSGER
TASGGASAAPAAPPSDWKNIDDHHVIQAIIRAYQSRGHLAADLDPLGIVGPKKRTSVDGT
QRHAAREVLRQHFSYIFNDLNTVFKLPSSTMIGGDQEFLSLKEILDRLERIYCGHIGVEY
MQITSLTKTNWLRDRFEKPGGLDLTKEEKKLILERLTRSTGFENFLAKKFSSEKRFGLEG
CDIMIPAIKEVVDRATDHGVESILIGMAHRGRLNVLANICRKPISDILSQFHGLQATDSG
SGDVKYHLGVFQERLNRQTNRMVRITVVANPSHLEHVNPVLLGKARAEMFQRGDTCGSTV
MPIIIHGDASFSGQGVVYESMHLSDLPNYTTYGTIHIVSNNQVGFTTDPRFSRSSRYCTD
VAKVVNAPILHVNADDPEACIQCARIAIDYRTRFKKDVVIDIVGYRRNGHNEADEPMFTQ
PLMYQRIKKLKPCLQLYADKLIKEGVVTDSEFKAMVSSYEKICEDAWAKSKTIKTIKYSS
WIDSPWPGFFEGRDRLKLCPTGISTDTLKTIGNMFSTPPPPEHKFETHKGILRILAQRTQ
MVQDKVADWSLGEAFAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHHQSEDKVVYNSLD
HLYPDQAPYSVSNSSLSECAVLGFEHGYSMASPNALVMWEGQFGDFCNTAQCIIDTFIAS
GETKWVRQSGVVMLLPHSMEGMGPEHSSGRIERFLQMSDDDPDVYPDTCDADFVARQLMN
VNWIVTNLSTPANLFHCLRRQVKMGFRKPLINFSPKSLLRHPLARSPFKDFNECSCFQRI
IPDKGPAGKQPDCVQKLVFCSGKVYYDLVKERDDHEQVETVALVRVEQLCPFPYDLISQQ
LELYPKAELLWAQEEHKNMGAWSYVQPRFDTALLKNENESRCVSYHGRPPSASPATGNKV
QHYNEYKALITSIFGELTPENKKRIEDRIKKQQAKAKADAQSKPSTKPPAAPPKGGSSPP
PGPAPRKPLISLPSRPPRGGKQRSGSAPAPNLVDEDSAARNREPDASAYDGASPSAWKRS
GSAPAPSVVPRASASRSPSRKSPSPSHDGISPSTRQESLSKKKSGSAPAPTPTSRGPFRT
APSNTEFIKRRPAKDYGSRNETQSTPGESELDPTKPQP

BLAST