GenomeNet

>dme:Dmel_CG9042 K00006 glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8] | (RefSeq) Gpdh; glycerol 3 phosphate dehydrogenase, isoform F (A)
MADKVNVCIVGSGNWGSAIAKIVGANAAALPEFEERVTMFVYEELIDGKKLTEIINETHE
NVKYLKGHKLPPNVVAVPDLVEAAKNADILIFVVPHQFIPNFCKQLLGKIKPNAIAISLI
KGFDKAEGGGIDLISHIITRHLKIPCAVLMGANLANEVAEGNFCETTIGCTDKKYGKVLR
DLFQANHFRVVVVDDADAVEVCGALKNIVACGAGFVDGLKLGDNTKAAVIRLGLMEMIRF
VDVFYPGSKLSTFFESCGVADLITTCYGGRNRRVSEAFVTSGKTIEELEKEMLNGQKLQG
PPTAEEVNYMLKNKGLEDKFPLFTAIHKICTNQLKPNDLIDCIRNHPEHMDTSIMPSPKL

BLAST