GenomeNet

>dme:Dmel_CG9564 K01312 trypsin [EC:3.4.21.4] | (RefSeq) Try29F; trypsin 29F, isoform D (A)
MRSSIGLTGMAKTILHLFIGGILLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQ
RSYHFCGGSLIAQGWVLTAAHCTEGSAILLSKVRIGSSRTSVGGQLVGIKRVHRHPKFDA
YTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSAVLRS
VTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGY
GCARPNYPGVYSRVSAVRDWISSVSGI

BLAST