GenomeNet

>dmo:Dmoj_GI10639 K04440 c-Jun N-terminal kinase [EC:2.7.11.24] | (RefSeq) GI10639 gene product from transcript GI10639-RB (A)
MAAHHYTVEVGDTNFTILSRYIKLRPIGSGAQGIVCAAYDTVTEQNVAIKKLSRPFQNVT
HAKRAYREFKLMKLVNHKNIIGLLNAFTPQRNLEEFQDVYLVMELMDANLCQVIQMDLDH
DRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGTTFMMTPY
VVTRYYRAPEVILGMGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPS
PSFMQRLQPTVRNYVENRPRYTGYAFDRLFPDGLFPNDNSQNSRRKASEARDLLSKMLVI
DPEQRISVDRALQHEYINVWYDAEEVDAPAPEPYDHSVDEREHTVEQWKELIYEEVMDYE
AHNVNR

BLAST