GenomeNet

>dmo:Dmoj_GI11556 K01785 aldose 1-epimerase [EC:5.1.3.3] | (RefSeq) uncharacterized protein (A)
MVRVVEDVFGIAVNPMTQKTDHVRRFTLCSEKGMSVAILTLGGIIQSIRVPDANAKLEDV
CLGYDDVAGYYRNQKFYIGAIIGRVADRVARGRFSLCSKDISLSRNHKDHYHLNGGYVGF
DSVIWDVVGIHKDGVTFQHVSPDGHEGYPGEVTVNINYSLNEAGCLGLRIEARAKETTCI
NIGHHCLFNLAGHSSGRDTLYQHMIMIKANKIVDTDLEQIPTGKLMPTRNTPYDFSTLTN
LGKRLNQVNRCPISGFDNNYCVDVDPNQVKLVARAVHPCSGRFVEIHTNQPGVHFSTANG
LPQEDRGDVPHVGKGGAHYSQHSAFCLQTQKYPDAMNNPEFPTVIINPGQLYDHQVVYRF
GACPKRV

BLAST