GenomeNet

>dmo:Dmoj_GI14608 K00799 glutathione S-transferase [EC:2.5.1.18] | (RefSeq) uncharacterized protein (A)
MTPVKFYFDFLNQASRSLYILLEASKIPFEAIPISMVKGEHLTGEFRDKVNRFRKLPAIT
DHGYQLSESVAIFRHLAREKLVPEHWYPHRHLGRSRVDEYLAWQQTNMDVACTDYFQQKW
LVPYLQKTRPSDNAVNSASKQLEHTLNDFEELFLNSRKFMLGENISYADLSAICEIDQPK
SIGYNTFKNRNKLARWYEAVREELGPYYTDVQKEFEAKLKLTNDAAQGEKQAQAVKQ

BLAST