GenomeNet

>dmo:Dmoj_GI18241 no KO assigned | (RefSeq) uncharacterized protein (A)
MLASENFQAHLYNRSSIYKPYNEELASMAKQLTTATADAAGIDAAQAAVDYGSPSKQMLG
SNNGSSSGSSNKTSSANSNNNNNNVANGLSSFVASHPSAEFEGFIRACVDEIIQLAVLQG
TNRSSKVVEWHEPAELRKLFDFELRDQPDSPDKLRQLLRETIRFSVKTGHPYFINQLYSG
VDPYALIGQWLTDALNPSVYTYEVAPVFTLMEEQVLGEMRRIVGFPNNGQGDGIFCPGGS
IANGYAISCARYQYAPESKKNGLFNAKPLVIFTSEDAHYSVEKLAMFMGFGSEHVRKIAT
NELGKMRLSDLEQQIQFCLDNNWQPLMVSATAGTTVLGAFDDLLGISELCRKHNMWMHVD
AAWGGGALMSKKYRQLLNGIERADSVTWNPHKLLSASQQCSTFLTRHTQILGQCHSTNAA
YLFQKDKFYDTSFDTGDKHIQCGRRADVFKFWFMWKAKGTKGFEAHVEQVFEMSEYFTNK
LRERPGFELVLDKPECTNITFWYVPPSLRQMERNQEFYDKLHKVAPKIKEAMIKKGSMMI
TYQPLRKLPNFFRLVLQNSCLDESDMLYFLNEIETLGQKL

BLAST