GenomeNet

>dmo:Dmoj_GI18415 K01312 trypsin [EC:3.4.21.4] | (RefSeq) uncharacterized protein (A)
MVSSSGLTLLPLIGCFLGGLALPLSPDLRLGRIVGGDSLPIHNAPWQVSIQLSAQHICGG
VIYSKDIIITAAHCVEQKSVTLLQVRVGANQHNSGGSLYPIASYKVHESYDDQLLHYDIA
LLRLATQLNYSLSVKAIALASSSPAAGSSVSVSGWGYTGQNGSTSFASSLQLVQLLVIDR
AECASAKYGYGWDFVGVEMICASAADKDACTGDSGGPMVSQGLLAGIVSWGYGCAQTNYP
GVYVDVAVLRHWIVKTANDL

BLAST