GenomeNet

>dmo:Dmoj_GI19680 K01283 peptidyl-dipeptidase A [EC:3.4.15.1] | (RefSeq) uncharacterized protein (A)
MLWQKLLPVLLLAVALAAATPTSNHSSQYEESTQRILDVATQRMRVIWDMRRRIFLQLTS
KGKSPLGGQAPSKQEVETETYKLLHELAANLSVVPVEQLRDPLLRRRVQRLAKLQLHGLR
PDDYEQAKDLLRTMQNFISGALVCTSDDCSARRPLAMYPQLYNLNMHTRVYEDLKTNWFY
WRIAINDKDTARSTFIDYVRLLRIAATYNGHVTPSRTWYLYYDTENFQAEMEEVIWEIMP
LYREMHAYLRHSAKLAYPKANIKDDGAISAPVFDQMLSQAWYSHQIFRTPYPKDQLPSVH
HRLEEVLVTPVKINNKATEFFESLGLNKMSSNFYERFLRRMNDDEGGPDCKSQVYYFPPD
VAMRYCPKPNYKKLMQIHGTMAELQYNIYKRELPFGLDTEPCPGFAAALGETAVLASGTP
RHLHRLYILLNDSLTENQSLNRLFRMGVHTLLAVPQYFINDKFLVDVMDGRIGVQDYNCA
YWRLQDKFAGVQPPRWRTAKDFDLDYKFYRGLQPEKSSTRKFISEVLGFQFYRSFCIASQ
QYKPGDPNFPLHNCDFHKSTEAGDLMREMMKLGATKHWRDIMFIATGERKLSGRGILEYF
APLFTWLKERNMQLELEPGWEADELCRNE

BLAST