GenomeNet

>dmo:Dmoj_GI20539 K00850 6-phosphofructokinase 1 [EC:2.7.1.11] | (RefSeq) uncharacterized protein, isoform E (A)
MNSDTNQRFLARGSQRDKGLAVFTSGGDSQGMNAAVRACVRMAIYLGCKVYFIREGYQGM
VDGGDCIQEASWSSVSSIIHRGGTIIGSARCKDFRERAGRLKAANNLVQRGITNLVVIGG
DGSLTGANLFRQEWSSLLDELEKNKSITPEQKNKYNVLHIVGLVGSIDNDFCGTDMTIGT
DTALHRIIEAIDAIASTAYSHQRTFIMEVMGRHCGYLAISAAIATEADFMFIPEEPAPTN
WQDDLCKKLAQERSAGQRLNIVIVAEGASDREGNPITAEQVRKVIDERLKHDARITVLGH
VQRGGNPSAFDRVLACRMGAEATLALMEATPESVPVVISLDGNQTVRVPLMECVERTQAV
AKAMAERRWADAVKLRGRSFERNLETYKMLTRLKPPKENFDEQGKGIEGYRLAVMHIGAP
ACGMNAAVRSFVRNAIYRGDVVYGINDGVEGLIAGNVRELGWSDVSGWVGQGGAYLGTKR
TLPEGKFKEIAARLKEFKIQGLLIIGGFESYHAAGQISDQRDNYPEFCIPIVVVPATISN
NVPGTEFSLGCDTGLNEITEICDRIRQSAQGTKRRVFVIETMGGYSGYLATLAGLAGGAD
AAYIYEEKFSIKDLQQDVYHMASKMAEGVSRGLILRNEKASENYTTDFIYRLYSEEGKGL
FTCRMNILGHMQQGGSPSPFDRNMGTKMAAKCVDWLATQIKNNIDSNGVVNCKSTDTATL
LGIVSRQYRFTPLVDLIADTNFDQRIPKKQWWLRLRPLLRILAKHDSAYEEEGMYITVEE
ECATDAVA

BLAST