GenomeNet

>dmo:Dmoj_GI21331 K02358 elongation factor Tu | (RefSeq) uncharacterized protein, isoform A (A)
MMSQAFASPISRIGVALRWNRRSLSTARFVRNVTRSRMVTSSTFIKNCPTANCIPATIGN
LQQYVRQYANEKKVFERTKPHCNVGTIGHVDHGKTTLTAAITKVLADKQLAESKKYNEID
NAPEEKARGITINVAHVEYQTETRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDG
AMPQTREHMLLAKQIGIDHIVVFINKVDAADQEMVDLVEMEIRELLTEMGYDGDKIPVIK
GSALCALEDKNPEIGANAILKLLEEVDNFIPTPVRELDKPFLLPVENVYSIPGRGTVVTG
RLERGVVKKGMECEFVGYNKVLKSTVTGVEMFHQILEEAQAGDQLGALVRGVKRDDIKRG
MVMCKPGSVKALDQLEAQVYILSKEEGGRTKPFMSFIQLQMFSRTWDCAVQVQIPDKEMV
MPGEDTKLILRLIRPMVLEQGQRFTLRDGNLTLGTGVVTNVLPALTESQRSELTEGKKAR
EKKVAAKK

BLAST