GenomeNet

>dmo:Dmoj_GI22314 K01077 alkaline phosphatase [EC:3.1.3.1] | (RefSeq) uncharacterized protein, isoform A (A)
MQSVLLILLGISLGAWSATVQPPPVIQTLSAAGSNGIGPEFQVTEKQDPASEDAQFWRQV
GLKQLSKTIEKAKRAKDSSYQHKAKNIIIFIGDGMGLSTISAGRIYKGQYLKHGHGEEEM
LSFDEFPFTGLAKTYNVDKQVPDSAGTATAIFSGVKTDYGAIGMDSTRSTTNASQGRLDS
IMDWAQREGKRTGVVTTTRITHATPAATYARIYHRDWECDTEVPQESVGIHADIARQLVE
NAPGNKLNVVLGGGLSPMGAFNESEVKTVQFEGGTETICKRGDNRNLATEWLQRHANDSK
EAKLVYTREQLLQVDVKEVDHLMGLFRNNHITYSIAREEGEPSLQDMTEAAIGVLERGDK
SKGYVLLVEGGRIDQGHHQNYARAALHEVYELDLAVQAALKMTDSDETLIIVTADHSHSV
TFNGYPERGADILGAANLHKPKDPMVYETITYANGPGYFDHLANETKPANSSNVWRPLKM
YTKEQIESPTYRHMATLALKDETHGGEDVIVFASGPGSSLVRGVFEQNYLAYVMSYAGCM
GPVKSFDESCQRHLSSAGHSKSESSAAALRLTLLPLLAAWLIVQLL

BLAST